Recombinant Human Tissue Inhibitor of Metalloproteinases 2/TIMP-2 (C-6His)

Contact with us

Size

50 ug

Price

497 EUR

Catalog no.

C459-50

Trusted suppliers.

Your order will be processed professionally, safely and quickly. We use the services of proven suppliers.

Order on Gentaur.com [497 EUR]

Species reactivity

Human

Tissue

tissue

UniProt number

P16035

Estimated molecular weight

22,79 kDa

Origin

Human cells

Group

recombinants

Shipping condition

Ambient/Room Temperature

Source

Recombinants or rec. proteins

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Package form

Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Description

Recombinant Human Tissue Inhibitor of Metalloproteinases 2 is produced by our Mammalian expression system and the target gene encoding Cys27-Pro220 is expressed with a 6His tag at the C-terminus.

Peptide sequence

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDPVDHHHHHH

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Reconstitution conditions

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Additional description

Tissue, pathway, proteinase, peptidase, protease ,acrosin, lipoprotein, activator, caspase, trypsin, papain, esterase inhibitors are proteins or receptor ligands or receptor antagonists that bind to an enzyme receptor and decreases its activity. Since blocking an enzyme's activity can kill a pathogen or correct a metabolic imbalance, many drugs are enzyme inhibitors. Not all receptor antagonist that bind to enzymes are inhibitors; enzyme activator ligands or agonists bind to enzymes and increase their enzymatic activity, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme.6