500 ug
1614 EUR
CC68-500
Your order will be processed professionally, safely and quickly. We use the services of proven suppliers.
Mouse
tissue
P25785
22,5 kDa
Human cells
recombinants
Mus musculus
Dry ice/ice packs
Recombinants or rec. proteins
Greater than 95% as determined by reducing SDS-PAGE.
See included datasheet or contact us for more information.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,pH7.5.
Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Recombinant Mouse Tissue Inhibitor of Metalloproteinases 2 is produced by our expression system and the target gene encoding Cys27-Pro220 is expressed
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDPHHHHHH
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Tissue, pathway, proteinase, peptidase, protease ,acrosin, lipoprotein, activator, caspase, trypsin, papain, esterase inhibitors are proteins or receptor ligands or receptor antagonists that bind to an enzyme receptor and decreases its activity. Since blocking an enzyme's activity can kill a pathogen or correct a metabolic imbalance, many drugs are enzyme inhibitors. Not all receptor antagonist that bind to enzymes are inhibitors; enzyme activator ligands or agonists bind to enzymes and increase their enzymatic activity, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme.6