Recombinant Mouse Tissue Inhibitor of Metalloproteinases 2/TIMP-2 (C-6His)

Contact with us

Size

500 ug

Price

1614 EUR

Catalog no.

CC68-500

Trusted suppliers.

Your order will be processed professionally, safely and quickly. We use the services of proven suppliers.

Order on Gentaur.com [1614 EUR]

Species reactivity

Mouse

Tissue

tissue

UniProt number

P25785

Estimated molecular weight

22,5 kDa

Origin

Human cells

Group

recombinants

Latin name

Mus musculus

Shipping condition

Dry ice/ice packs

Source

Recombinants or rec. proteins

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Reconstitution conditions

See included datasheet or contact us for more information.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Package form

Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,pH7.5.

Storage conditions

Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Description

Recombinant Mouse Tissue Inhibitor of Metalloproteinases 2 is produced by our expression system and the target gene encoding Cys27-Pro220 is expressed

Peptide sequence

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDPHHHHHH

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.

Additional description

Tissue, pathway, proteinase, peptidase, protease ,acrosin, lipoprotein, activator, caspase, trypsin, papain, esterase inhibitors are proteins or receptor ligands or receptor antagonists that bind to an enzyme receptor and decreases its activity. Since blocking an enzyme's activity can kill a pathogen or correct a metabolic imbalance, many drugs are enzyme inhibitors. Not all receptor antagonist that bind to enzymes are inhibitors; enzyme activator ligands or agonists bind to enzymes and increase their enzymatic activity, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme.6